Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Protease HtpX (htpX)

This Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Protease HtpX (htpX) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

B8D7L3

Expression Region

1-292

Origin

Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTRIVLFLLTNLAVMLIFSLILFLTGIQSNTIYGLLIMSGLFGFSGSILSLILSKWIALR SVNGEIITHPRNEVESWLINTVRQQSIQKGIIMPQIAVYHATDINAFATGARRNSALIAV STGLLENMTHHEAEAVIAHEISHIANGDMITMTLVQGVVNTFVIFISRFLSQIISNVMSS NRNENNTEEKNSFVYFLVSTFLELIFGILASIITMWFSRHREFYADASSAKMVGREKMIA ALNRLKTSHEPQESDSMIAFCINGKSKSFLKLFASHPSLENRIEALYNQEYM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF488A conjugate, 0.1mg/mL
BNC880152-500 1x 500 µL

CD11c (HC1/1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
BNC401429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL
BNC800146-100 1x 100 µL

CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
BNC400270-100 1x 100 µL

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF405S conjugate, 0.1mg/mL
BNC040342-100 1x 100 µL

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Golgi Complex (Marker for Human Cells) (GLG1/2829R), CF740 conjugate, 0.1mg/mL
BNC742829-100 1x 100 µL

Golgi Complex (Marker for Human Cells) (GLG1/2829R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details