Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Frankia sp. Undecaprenyl-diphosphatase 2 (uppP2)

This Recombinant Frankia sp. Undecaprenyl-diphosphatase 2 (uppP2) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase 2, EC= 3.6.1.27, Bacitracin resistance protein 2, Undecaprenyl pyrophosphate phosphatase 2

UniProt

Q2J987

Expression Region

1-292

Origin

Frankia sp. (strain CcI3)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFFEGTVLGLVQGLTEFLPVSSSAHLRIAAALAGWEDPGAAFTAVTQIGTETAVLIYFR RDIARIVAAWARSLTRREMRKDPDARTGWLVILGTLPIGLLGVTLQDAIEGPFRDLRLIA TTLIVLGLILGGADWYASKGRPQGRHSPLRPRKVLEDLSVRDGLLYGLAQSAALIPGVSR SGATISGGLLLGYTREAAARYSFLLAMPAVLASGVFELRSIGGKDADVAWGPTILATFVA FVTGYAAIAWFLRYISTRSFAPFVLYRVGLGLLLFSLLVGGALSPDAGAPPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-500 1x 500 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF568 conjugate, 0.1mg/mL
BNC680305-100 1x 100 µL

CD95 (B-R18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF647 conjugate, 0.1mg/mL
BNC470029-100 1x 100 µL

Fibronectin (TV-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL
BNC740253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL
BNC941820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL
BNC880965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details