Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1571 (MJ1571)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1571 (MJ1571) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1571

UniProt

Q58966

Expression Region

1-292

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFKIYNIKSRIIRENMNNKLFDKTIEHVIKYLNENIFFEKYTRISGLLQNIESRIKIISL VIFLVGSVLSKHILTLIIFNSIALILAYLSNIPLLQYLKRVYVFIPIFAGIIAIPVMFNF MTPGKDVFVILNNPHISITYEGLIYAITFTLRVATCVSFAVLIPITTQWNKVTSAIHKLG VPEVVITITNLAYRYIFLLLNFVLDMMYSRKSRVVNKLGMVESWKEAGKAIGALFIKTYQ MGEDXYYAMLSRGYNGEIKHIYREEIKIKDIAFLLFSIIITALLVLFDRGIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HER-4 / ERBB4 (ERBB4/2581), CF647 conjugate, 0.1mg/mL
BNC472581-100 1x 100 µL

HER-4 / ERBB4 (ERBB4/2581), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
A26C2/3 Antibody
8C17976-AAT 50 µg

A26C2/3 Antibody

Sign In for Pricing
View Details
STAT5A Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8H1]
TA502737BM 100 µL

STAT5A Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8H1]

Sign In for Pricing
View Details
Tpm3 Mouse Gene Knockout Kit (CRISPR)
KN518093 1 Kit

Tpm3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker), CF647 conjugate, 0.1mg/mL
BNC471675-100 1x 100 µL

Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: right
CS701764 5x 5 µm

Tissue FFPE Sections, Colon: right

Sign In for Pricing
View Details