Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1571 (MJ1571)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1571 (MJ1571) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1571

UniProt

Q58966

Expression Region

1-292

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFKIYNIKSRIIRENMNNKLFDKTIEHVIKYLNENIFFEKYTRISGLLQNIESRIKIISL VIFLVGSVLSKHILTLIIFNSIALILAYLSNIPLLQYLKRVYVFIPIFAGIIAIPVMFNF MTPGKDVFVILNNPHISITYEGLIYAITFTLRVATCVSFAVLIPITTQWNKVTSAIHKLG VPEVVITITNLAYRYIFLLLNFVLDMMYSRKSRVVNKLGMVESWKEAGKAIGALFIKTYQ MGEDXYYAMLSRGYNGEIKHIYREEIKIKDIAFLLFSIIITALLVLFDRGIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Floor Standing Shaking Incubator BSFT-106
BSFT-106 1 Unit

Floor Standing Shaking Incubator BSFT-106

Sign In for Pricing
View Details
CAPON (NOS1AP) (NM_001126060) Human Over-expression Lysate
LC426640 20 µg

CAPON (NOS1AP) (NM_001126060) Human Over-expression Lysate

Sign In for Pricing
View Details
CPSF7 (NM_001136040) Human Over-expression Lysate
LY427787 100 µg

CPSF7 (NM_001136040) Human Over-expression Lysate

Sign In for Pricing
View Details
Basic Water Purification System BBPS-103
BBPS-103 1 Unit

Basic Water Purification System BBPS-103

Sign In for Pricing
View Details
Glycine-13C2
TRC-G615998-25MG 25 mg

Glycine-13C2

Sign In for Pricing
View Details
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), CF640R conjugate, 0.1mg/mL
BNC401628-100 1x 100 µL

CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details