Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1571 (MJ1571)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1571 (MJ1571) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1571

UniProt

Q58966

Expression Region

1-292

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFKIYNIKSRIIRENMNNKLFDKTIEHVIKYLNENIFFEKYTRISGLLQNIESRIKIISL VIFLVGSVLSKHILTLIIFNSIALILAYLSNIPLLQYLKRVYVFIPIFAGIIAIPVMFNF MTPGKDVFVILNNPHISITYEGLIYAITFTLRVATCVSFAVLIPITTQWNKVTSAIHKLG VPEVVITITNLAYRYIFLLLNFVLDMMYSRKSRVVNKLGMVESWKEAGKAIGALFIKTYQ MGEDXYYAMLSRGYNGEIKHIYREEIKIKDIAFLLFSIIITALLVLFDRGIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LGSN activation kit by CRISPRa
GA109872 1 Kit

Human LGSN activation kit by CRISPRa

Sign In for Pricing
View Details
CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-500 1x 500 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nitritocobalamin (~90% by HPLC)
TRC-N490240-10MG 10 mg

Nitritocobalamin (~90% by HPLC)

Sign In for Pricing
View Details
Human DHRS7 activation kit by CRISPRa
GA109913 1 Kit

Human DHRS7 activation kit by CRISPRa

Sign In for Pricing
View Details
SH3KBP1 (NM_001024666) Human Over-expression Lysate
LC422529 20 µg

SH3KBP1 (NM_001024666) Human Over-expression Lysate

Sign In for Pricing
View Details
USP13 Human Gene Knockout Kit (CRISPR)
KN202190BN 1 Kit

USP13 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details