Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-23 (CLDN23)

This Recombinant Human Claudin-23 (CLDN23) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Claudin-23

UniProt

Q96B33

Expression Region

1-292

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRTPVVMTLGMVLAPCGLLLNLTGTLAPGWRLVKGFLNQPVDVELYQGLWDMCREQSSRE RECGQTDQWGYFEAQPVLVARALMVTSLAATVLGLLLASLGVRCWQDEPNFVLAGLSGVV LFVAGLLGLIPVSWYNHFLGDRDVLPAPASPVTVQVSYSLVLGYLGSCLLLLGGFSLALS FAPWCDERCRRRRKGPSAGPRRSSVSTIQVEWPEPDLAPAIKYYSDGQHRPPPAQHRKPK PKPKVGFPMPRPRPKAYTNSVDVLDGEGWESQDAPSCSTHPCDSSLPCDSDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human IL-1 alpha/IL1A protein
ILA0801-050 50 µg

Recombinant human IL-1 alpha/IL1A protein

Sign In for Pricing
View Details
FAM165A 3'UTR GFP Stable Cell Line
TU057611 1.0 mL

FAM165A 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Interleukin II (60-70)
MBS8246689-01 1 mg

Interleukin II (60-70)

Sign In for Pricing
View Details
Interleukin II (60-70)
MBS8246689-02 5 mg

Interleukin II (60-70)

Sign In for Pricing
View Details
Interleukin II (60-70)
MBS8246689-03 10 mg

Interleukin II (60-70)

Sign In for Pricing
View Details
Interleukin II (60-70)
MBS8246689-04 5x 10 mg

Interleukin II (60-70)

Sign In for Pricing
View Details