Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-23 (CLDN23)

This Recombinant Human Claudin-23 (CLDN23) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Claudin-23

UniProt

Q96B33

Expression Region

1-292

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRTPVVMTLGMVLAPCGLLLNLTGTLAPGWRLVKGFLNQPVDVELYQGLWDMCREQSSRE RECGQTDQWGYFEAQPVLVARALMVTSLAATVLGLLLASLGVRCWQDEPNFVLAGLSGVV LFVAGLLGLIPVSWYNHFLGDRDVLPAPASPVTVQVSYSLVLGYLGSCLLLLGGFSLALS FAPWCDERCRRRRKGPSAGPRRSSVSTIQVEWPEPDLAPAIKYYSDGQHRPPPAQHRKPK PKPKVGFPMPRPRPKAYTNSVDVLDGEGWESQDAPSCSTHPCDSSLPCDSDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PACSIN2 Recombinant Protein (N-His)
HP612022-01 50 µg

Human PACSIN2 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human PACSIN2 Recombinant Protein (N-His)
HP612022-02 100 µg

Human PACSIN2 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human PACSIN2 Recombinant Protein (N-His)
HP612022-03 1 mg

Human PACSIN2 Recombinant Protein (N-His)

Sign In for Pricing
View Details
WB-Validated APBB1 Knockdown Cell Lysate Kit
E46C61435 Kit (100 µg KD + 100 µg WT)

WB-Validated APBB1 Knockdown Cell Lysate Kit

Sign In for Pricing
View Details
Rno-miR-351-3p miRNA Antagomir
CIS0385-01 10 nmol

Rno-miR-351-3p miRNA Antagomir

Sign In for Pricing
View Details
Rno-miR-351-3p miRNA Antagomir
CIS0385-02 20 nmol

Rno-miR-351-3p miRNA Antagomir

Sign In for Pricing
View Details