Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-23 (CLDN23)

This Recombinant Human Claudin-23 (CLDN23) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Claudin-23

UniProt

Q96B33

Expression Region

1-292

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRTPVVMTLGMVLAPCGLLLNLTGTLAPGWRLVKGFLNQPVDVELYQGLWDMCREQSSRE RECGQTDQWGYFEAQPVLVARALMVTSLAATVLGLLLASLGVRCWQDEPNFVLAGLSGVV LFVAGLLGLIPVSWYNHFLGDRDVLPAPASPVTVQVSYSLVLGYLGSCLLLLGGFSLALS FAPWCDERCRRRRKGPSAGPRRSSVSTIQVEWPEPDLAPAIKYYSDGQHRPPPAQHRKPK PKPKVGFPMPRPRPKAYTNSVDVLDGEGWESQDAPSCSTHPCDSSLPCDSDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL2RA Rabbit Polyclonal Antibody
E10G04045 100 µL

IL2RA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SCFD2 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-17281R-BF405 100 µL

SCFD2 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
TEAD3 Rabbit Polyclonal Antibody
orb574666 100 µL

TEAD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Hrasls sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3472405 3x 1.0 µg

Hrasls sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
BAM - 18P
M42008-01 100 mg

BAM - 18P

Sign In for Pricing
View Details
BAM - 18P
M42008-02 25 mg

BAM - 18P

Sign In for Pricing
View Details