Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xanthomonas campestris pv. campestris Protease HtpX (htpX)

This Recombinant Xanthomonas campestris pv. campestris Protease HtpX (htpX) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q8P8F0

Expression Region

1-292

Origin

Xanthomonas campestris pv. campestris (strain ATCC 33913 / NCPPB 528 / LMG 568)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFNRVVLFLLTNFAVLILAGIVMSVLGVNPTQMSGLLVMAAIFGFGGSFISLLLSKFMAK RSTGAQVITEPRTQTERWLVDTVRRQAQAAGIGMPEVAIYDGPEINAFATGANRNNALVA VSTGLLQHMREDEAEAVLGHEIAHIANGDMVTMALLQGVLNTFVIVLARVVGGIIDSALS GNRDSGRGFAYYIIVFVLEMVFGLFATMIAMWFSRRREFRADAGGAQLAGRNKMIAALER LSLNHGQNTLPSQVQAFGISGGVGEGLRRLFLSHPPLTERIAALRASNGTAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
BNC472848-500 1x 500 µL

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL
BNC880149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF740 conjugate, 0.1mg/mL
BNC740342-100 1x 100 µL

CD43 (84-3C1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ksp-Cadherin / CDH16 (CDH16/1071), CF740 conjugate, 0.1mg/mL
BNC741071-500 1x 500 µL

Ksp-Cadherin / CDH16 (CDH16/1071), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (r1415-1), CF680 conjugate, 0.1mg/mL
BNC801797-100 1x 100 µL

Histone H1 (Nuclear Marker) (r1415-1), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Involucrin (SY5), CF405S conjugate, 0.1mg/mL
BNC040678-100 1x 100 µL

Involucrin (SY5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details