Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Presqualene diphosphate phosphatase (Ppapdc2)

This Recombinant Mouse Presqualene diphosphate phosphatase (Ppapdc2) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Presqualene diphosphate phosphatase, EC= 3.1.3.-, Phosphatidic acid phosphatase type 2 domain-containing protein 2

UniProt

Q9D4F2

Expression Region

1-292

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSPRRTIEGRPLGSSGGSSVPGSPAHGGGSGGGRFEFQSLLNCRAGADPACARLRASDS PVHRRGSFPLAASGPAQAAPAPPPEDARMNLNPSFLGIALRSLLAIDLWLSKKLGVCAGE SSAWGSVRPLMKLLEISGHGIPWLLGTLYCLLRSDSWAGREVLMNLLFALLLDLLLVAVI KGLVRRRRPAHNQKDMFFTLSVDRYSFPSGHATRAALVSRFILNHLVLAIPLRVLVVLWA FVLGLSRVMLGRHNVTDVAFGFFLGYMQYSIVDYCWLSPHNVPVLFVLWNQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Schizosaccharomyces pombe Uncharacterized amino-acid permease C1039.01 (SPAC1039.01), partial
MBS7102166 Inquire

Recombinant Schizosaccharomyces pombe Uncharacterized amino-acid permease C1039.01 (SPAC1039.01), partial

Sign In for Pricing
View Details
Rabbit Polyclonal Caspase 5 Antibody [FITC]
NBP1-77209F 0.1 mL

Rabbit Polyclonal Caspase 5 Antibody [FITC]

Sign In for Pricing
View Details
CARTPT Protein (C-cleavage, Human)
P522603 100 µg

CARTPT Protein (C-cleavage, Human)

Sign In for Pricing
View Details
Box, polypropylene, with 12x8 tubes, U, 1,2ml, 102280 without cap, lid, subpacked per 10 pieces, 100 pieces per CAR
975270 100 pieces per CAR

Box, polypropylene, with 12x8 tubes, U, 1,2ml, 102280 without cap, lid, subpacked per 10 pieces, 100 pieces per CAR

Sign In for Pricing
View Details
OR10A2 Rabbit Polyclonal Antibody
orb327064 100 µL

OR10A2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Goat Autophagy protein 5 (ATG5) ELISA Kit
GTR10324534 96 Well

Goat Autophagy protein 5 (ATG5) ELISA Kit

Sign In for Pricing
View Details