Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protease HtpX (htpX)

This Recombinant Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

P65818

Expression Region

1-293

Origin

Salmonella typhi

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLLIMALLFGFGGSFISLLMSKWMALK SVGGEVIEQPRNERERWLMNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRIIAQIAAGFLGG NRDEGEGSNGNPLIYFAVATVLELVFGILASIITMWFSRYREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRSGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZIC5 (651-663) Goat Polyclonal Antibody
AP22531PU-N 50 µg

ZIC5 (651-663) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Terbinafine N-oxide
TRC-T107505-50MG 50 mg

Terbinafine N-oxide

Sign In for Pricing
View Details
ERAB (HSD17B10) Human Gene Knockout Kit (CRISPR)
KN401734 1 Kit

ERAB (HSD17B10) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CIITA (NM_000246) Human Over-expression Lysate
LY424845 100 µg

CIITA (NM_000246) Human Over-expression Lysate

Sign In for Pricing
View Details
Colloidal Gold Conjugated Cicer arietinum Lectin (Chick Pea) -CPA-,  20nm
GP-6601-20 1 mL

Colloidal Gold Conjugated Cicer arietinum Lectin (Chick Pea) -CPA-, 20nm

Sign In for Pricing
View Details
Human LRRC38 activation kit by CRISPRa
GA114962 1 Kit

Human LRRC38 activation kit by CRISPRa

Sign In for Pricing
View Details