Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protease HtpX (htpX)

This Recombinant Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

P65818

Expression Region

1-293

Origin

Salmonella typhi

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLLIMALLFGFGGSFISLLMSKWMALK SVGGEVIEQPRNERERWLMNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRIIAQIAAGFLGG NRDEGEGSNGNPLIYFAVATVLELVFGILASIITMWFSRYREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRSGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEF2A pSer408 Rabbit Polyclonal Antibody
AP02539PU-N 100 µL

MEF2A pSer408 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MSX2 (1-77) Mouse Monoclonal Antibody [Clone ID: 2E12]
AM26583AF-N 100 µg

MSX2 (1-77) Mouse Monoclonal Antibody [Clone ID: 2E12]

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/1799R), CF740 conjugate, 0.1mg/mL
BNC741799-500 1x 500 µL

P53 Tumor Suppressor Protein (TP53/1799R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Chlorobenzophenone
TRC-C364485-5G 5 g

4-Chlorobenzophenone

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), 0.2mg/mL
BNUB1953-500 1x 500 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Human Proenkephalin-B/PDYN Protein (His Tag)
PKSH033558-01 10 µg

Recombinant Human Proenkephalin-B/PDYN Protein (His Tag)

Sign In for Pricing
View Details