Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protease HtpX (htpX)

This Recombinant Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

P65814

Expression Region

1-293

Origin

Shigella flexneri

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLMIMALLFGFGGSFVSLLMSKWMALR SVGGEVIEQPRNERERWLVNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRILAQLAAGFMGG NRDEGEESNGNPLIYFAVATVLELVFGILASIITMWFSRHREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRTGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AVX 13616 10mg
A20907-10 10 mg

AVX 13616 10mg

Sign In for Pricing
View Details
Cep128 (NM_181815) Mouse Untagged Clone
MC223562 10 µg

Cep128 (NM_181815) Mouse Untagged Clone

Sign In for Pricing
View Details
Human NEU4 qPCR Primer Pair
QH62265S 200 Tests

Human NEU4 qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Defensin-like protein 113 (At5g27495)
MBS1357434-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Defensin-like protein 113 (At5g27495)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Defensin-like protein 113 (At5g27495)
MBS1357434-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Defensin-like protein 113 (At5g27495)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Defensin-like protein 113 (At5g27495)
MBS1357434-03 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Defensin-like protein 113 (At5g27495)

Sign In for Pricing
View Details