Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protease HtpX (htpX)

This Recombinant Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

P65814

Expression Region

1-293

Origin

Shigella flexneri

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLMIMALLFGFGGSFVSLLMSKWMALR SVGGEVIEQPRNERERWLVNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRILAQLAAGFMGG NRDEGEESNGNPLIYFAVATVLELVFGILASIITMWFSRHREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRTGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lysosome-Associated Membrane Glycoprotein 2 (LAMP2) Antibody (PE/ATTO 594)
abx443681 100 µg

Lysosome-Associated Membrane Glycoprotein 2 (LAMP2) Antibody (PE/ATTO 594)

Sign In for Pricing
View Details
CD1D ORF Vector (Human) (pORF)
ORF002098 1.0 µg DNA

CD1D ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Histone H3 Peptide Biotinylated
B2012569 100 µg

Histone H3 Peptide Biotinylated

Sign In for Pricing
View Details
Lentiviral mouse Ino80 shRNA (UAS) - Lentiviral mouse Ino80 shRNA (UAS, RFP) (25)
GTR15259751 1 Vial

Lentiviral mouse Ino80 shRNA (UAS) - Lentiviral mouse Ino80 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
CHO Monoclonal VEGF Antibody (Domantis patent anti-VEGF) - Humanized - (Dry Ice)
NBP3-27976-50ug 50 µg

CHO Monoclonal VEGF Antibody (Domantis patent anti-VEGF) - Humanized - (Dry Ice)

Sign In for Pricing
View Details
SMAD3 (NM_005902) Human Tagged ORF Clone Lentiviral Particle
RC208749L1V 200 µL

SMAD3 (NM_005902) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details