Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protease HtpX (htpX)

This Recombinant Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

P65812

Expression Region

1-293

Origin

Escherichia coli O6

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLMIMALLFGFGGSFVSLLMSKWMALR SVGGEVIEQPRNERERWLVNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRILAQLAAGFMGG NRDEGEESNGNPLIYFAVATVLELVFGILASIITMWFSRHREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRTGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Complement C1q tumor necrosis factor-related protein 1 (C1QTNF1/CTRP1) ELISA Kit
SL1715Ra-01 48 Tests

Rat Complement C1q tumor necrosis factor-related protein 1 (C1QTNF1/CTRP1) ELISA Kit

Sign In for Pricing
View Details
Rat Complement C1q tumor necrosis factor-related protein 1 (C1QTNF1/CTRP1) ELISA Kit
SL1715Ra-02 96 Tests

Rat Complement C1q tumor necrosis factor-related protein 1 (C1QTNF1/CTRP1) ELISA Kit

Sign In for Pricing
View Details
Signaling Threshold Regulating Transmembrane Adaptor 1 (SIT1) Antibody
abx029063-01 80 µL

Signaling Threshold Regulating Transmembrane Adaptor 1 (SIT1) Antibody

Sign In for Pricing
View Details
Signaling Threshold Regulating Transmembrane Adaptor 1 (SIT1) Antibody
abx029063-02 400 µL

Signaling Threshold Regulating Transmembrane Adaptor 1 (SIT1) Antibody

Sign In for Pricing
View Details
PAGE1 Antibody
orb1316801-01 30 µL

PAGE1 Antibody

Sign In for Pricing
View Details
PAGE1 Antibody
orb1316801-02 50 μL

PAGE1 Antibody

Sign In for Pricing
View Details