Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protease HtpX (htpX)

This Recombinant Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

P65812

Expression Region

1-293

Origin

Escherichia coli O6

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLMIMALLFGFGGSFVSLLMSKWMALR SVGGEVIEQPRNERERWLVNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRILAQLAAGFMGG NRDEGEESNGNPLIYFAVATVLELVFGILASIITMWFSRHREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRTGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal TIM-3 Antibody (215008R) [Janelia Fluor 669]
FAB1529RJF669 0.1 mL

Rat Monoclonal TIM-3 Antibody (215008R) [Janelia Fluor 669]

Sign In for Pricing
View Details
Recombinant Human LCE3C Protein
E30P12581 20 µg

Recombinant Human LCE3C Protein

Sign In for Pricing
View Details
V-ATPase B2 (D-11) Alexa Fluor® 546
sc-166045 AF546 200 µg/mL

V-ATPase B2 (D-11) Alexa Fluor® 546

Sign In for Pricing
View Details
Abcg3l1 (NM_001004076) Rat Tagged Lenti ORF Clone
RR203426L4 10 µg

Abcg3l1 (NM_001004076) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human TNF alpha (C-6His)
EPT101 10 µg

Recombinant Human TNF alpha (C-6His)

Sign In for Pricing
View Details
Rabbit Polyclonal MeCP2 Antibody [PerCP]
NBP2-50060PCP 0.1 mL

Rabbit Polyclonal MeCP2 Antibody [PerCP]

Sign In for Pricing
View Details