Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protease HtpX (htpX)

This Recombinant Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

P65813

Expression Region

1-293

Origin

Escherichia coli O157:H7

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLMIMALLFGFGGSFVSLLMSKWMALR SVGGEVIEQPRNERERWLVNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRILAQLAAGFMGG NRDEGEESNGNPLIYFAVATVLELVFGILASIITMWFSRHREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRTGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEAD1 Recombinant Rabbit Monoclonal Antibody [JE52-71]
ET7111-04 100 µL

TEAD1 Recombinant Rabbit Monoclonal Antibody [JE52-71]

Sign In for Pricing
View Details
Sulfo-N-succinimidyl 6-[3-(2-Pyridyldithio)propionamido] Hexanoate, Sodium Salt (Technical Grade)
TRC-S755003-50MG 50 mg

Sulfo-N-succinimidyl 6-[3-(2-Pyridyldithio)propionamido] Hexanoate, Sodium Salt (Technical Grade)

Sign In for Pricing
View Details
Human APP / Abeta40 Protein, His Tag
APP-H51H7-100ug 100 µg

Human APP / Abeta40 Protein, His Tag

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Swine IgG,  20nm
GAF-471-20 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Swine IgG, 20nm

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS651164 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
ATP8B4 Human Gene Knockout Kit (CRISPR)
KN416096 1 Kit

ATP8B4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details