Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protease HtpX (htpX)

This Recombinant Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A1ABZ5

Expression Region

1-293

Origin

Escherichia coli O1:K1 / APEC

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLMIMALLFGFGGSFVSLLMSKWMALR SVGGEVIEQPRNERERWLVNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRILAQLAAGFMGG NRDEGEESNGNPLIYFAVATVLELVFGILASIITMWFSRHREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRTGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium 2-(2-Amino-3-benzoylphenyl)acetate
TRC-S960130-50MG 50 mg

Sodium 2-(2-Amino-3-benzoylphenyl)acetate

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL
BNC470178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sodium Metasilicate
TRC-S224405-1G 1 g

Sodium Metasilicate

Sign In for Pricing
View Details
RNF21 (TRIM34) (NM_001003827) Human Over-expression Lysate
LC424025 20 µg

RNF21 (TRIM34) (NM_001003827) Human Over-expression Lysate

Sign In for Pricing
View Details
KCNIP1 (NM_001278340) Human Tagged ORF Clone
RG236403 10 µg

KCNIP1 (NM_001278340) Human Tagged ORF Clone

Sign In for Pricing
View Details
PTEN (NM_000314) Human Recombinant Protein
TP762463 50 µg

PTEN (NM_000314) Human Recombinant Protein

Sign In for Pricing
View Details