Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protease HtpX (htpX)

This Recombinant Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A1ABZ5

Expression Region

1-293

Origin

Escherichia coli O1:K1 / APEC

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLMIMALLFGFGGSFVSLLMSKWMALR SVGGEVIEQPRNERERWLVNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRILAQLAAGFMGG NRDEGEESNGNPLIYFAVATVLELVFGILASIITMWFSRHREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRTGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PRAK (MAPKAPK5) activation kit by CRISPRa
GA105664 1 Kit

Human PRAK (MAPKAPK5) activation kit by CRISPRa

Sign In for Pricing
View Details
HSD17B13 (NM_178135) Human Over-expression Lysate
LC440269 20 µg

HSD17B13 (NM_178135) Human Over-expression Lysate

Sign In for Pricing
View Details
ORAV1 (ORAOV1) Rabbit Polyclonal Antibody
TA368101 100 µL

ORAV1 (ORAOV1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Apolipoprotein CII (APOC2) activation kit by CRISPRa
GA100243 1 Kit

Human Apolipoprotein CII (APOC2) activation kit by CRISPRa

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD16 Antibody[3G8]
E-AB-F1236M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD16 Antibody[3G8]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD16 Antibody[3G8]
E-AB-F1236M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD16 Antibody[3G8]

Sign In for Pricing
View Details