Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cronobacter sakazakii Protease HtpX (htpX)

This Recombinant Cronobacter sakazakii Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A7MKG5

Expression Region

1-293

Origin

Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVTGLLIMALLFGFGGSIVSLLMSKWMALK SVGGEVIEAPRNETERWLMDTVAQQSRQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSRDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRIIAQVAAGFLGG NRDEGEESNGNPLIYFAVATVLELVFGILASIITMWFSRYREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEASSMMAFCINGKSKSLSELFMTHPPLDKRIEALRSGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARFGAP3 Antibody
OC-206-01 50 μL

ARFGAP3 Antibody

Sign In for Pricing
View Details
ARFGAP3 Antibody
OC-206-02 100 µL

ARFGAP3 Antibody

Sign In for Pricing
View Details
ARFGAP3 Antibody
OC-206-03 1 mL

ARFGAP3 Antibody

Sign In for Pricing
View Details
PNPO (C-term) Rabbit Polyclonal Antibody
AP53372PU-N 400 µL

PNPO (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-butylpiperidine-2-carboxylic acid
TRC-B490855-50MG 50 mg

1-butylpiperidine-2-carboxylic acid

Sign In for Pricing
View Details
Oxyphenisatine Dipropionate
TRC-O772550-10MG 10 mg

Oxyphenisatine Dipropionate

Sign In for Pricing
View Details