Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cronobacter sakazakii Protease HtpX (htpX)

This Recombinant Cronobacter sakazakii Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A7MKG5

Expression Region

1-293

Origin

Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVTGLLIMALLFGFGGSIVSLLMSKWMALK SVGGEVIEAPRNETERWLMDTVAQQSRQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSRDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRIIAQVAAGFLGG NRDEGEESNGNPLIYFAVATVLELVFGILASIITMWFSRYREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEASSMMAFCINGKSKSLSELFMTHPPLDKRIEALRSGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha Recombinant Rabbit monoclonal Antibody
HA750897 100 µL

TNF alpha Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
NFE4 (NM_001085386) Human Over-expression Lysate
LY421283 100 µg

NFE4 (NM_001085386) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit IgG for IP, AlpSdAbs® VHH (HRP)
HA710055 100 µg

Rabbit IgG for IP, AlpSdAbs® VHH (HRP)

Sign In for Pricing
View Details
(5-Chloro-2-nitrophenyl)(phenyl)carbamic Acid tert-Butyl Ester
TRC-C368545-250MG 250 mg

(5-Chloro-2-nitrophenyl)(phenyl)carbamic Acid tert-Butyl Ester

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary: right
CP565825 150 µg

Tissue Protein Lysate, Ovary: right

Sign In for Pricing
View Details
Fmoc-hydrazino TentaGel® TRT Resin
S30070.5G 5 g

Fmoc-hydrazino TentaGel® TRT Resin

Sign In for Pricing
View Details