Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cronobacter sakazakii Protease HtpX (htpX)

This Recombinant Cronobacter sakazakii Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A7MKG5

Expression Region

1-293

Origin

Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVTGLLIMALLFGFGGSIVSLLMSKWMALK SVGGEVIEAPRNETERWLMDTVAQQSRQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSRDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRIIAQVAAGFLGG NRDEGEESNGNPLIYFAVATVLELVFGILASIITMWFSRYREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEASSMMAFCINGKSKSLSELFMTHPPLDKRIEALRSGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BOB1 (POU2AF1) Mouse Monoclonal Antibody [Clone ID: OTI2E1]
CF807928 100 µg

BOB1 (POU2AF1) Mouse Monoclonal Antibody [Clone ID: OTI2E1]

Sign In for Pricing
View Details
CD44v4/5 (Marker of Tumor Metastasis) (3D2), CF740 conjugate, 0.1mg/mL
BNC743075-100 1x 100 µL

CD44v4/5 (Marker of Tumor Metastasis) (3D2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Canine Interleukin 2 (IL2) ELISA Kit
RD-IL2-c-01 96 Tests

Canine Interleukin 2 (IL2) ELISA Kit

Sign In for Pricing
View Details
Canine Interleukin 2 (IL2) ELISA Kit
RD-IL2-c-02 48 Tests

Canine Interleukin 2 (IL2) ELISA Kit

Sign In for Pricing
View Details
Abiraterone Acetate-d4
TRC-A108502-1MG 1 mg

Abiraterone Acetate-d4

Sign In for Pricing
View Details
UBE2D2 (NM_003339) Human Recombinant Protein
TP318795 20 µg

UBE2D2 (NM_003339) Human Recombinant Protein

Sign In for Pricing
View Details