Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella arizonae Protease HtpX (htpX)

This Recombinant Salmonella arizonae Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A9MNI0

Expression Region

1-293

Origin

Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLLIMALLFGFGGSFISLLMSKWMALK SVGGEVIEQPRNERERWLMNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRIIAQIAAGFLGG NRDEGEGSNGNPLIYFAVATVLELVFGILASIITMWFSRYREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRSGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmprss11d Mouse Gene Knockout Kit (CRISPR)
KN517933 1 Kit

Tmprss11d Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Slc3a2 Mouse Gene Knockout Kit (CRISPR)
KN316115RB 1 Kit

Slc3a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CHD4 Human Knockdown Lysate
LY300109 100 µg

CHD4 Human Knockdown Lysate

Sign In for Pricing
View Details
(R)-Ostarine
TRC-O703505-50MG 50 mg

(R)-Ostarine

Sign In for Pricing
View Details
Desalkyl Ebastine
TRC-D288770-5MG 5 mg

Desalkyl Ebastine

Sign In for Pricing
View Details
Cyanine 3 monoacid [equivalent to Cy3® acid]
140-AAT 5 mg

Cyanine 3 monoacid [equivalent to Cy3® acid]

Sign In for Pricing
View Details