Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype IB Protease HtpX (htpX)

This Recombinant Yersinia pseudotuberculosis serotype IB Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

B2K6A2

Expression Region

1-293

Origin

Yersinia pseudotuberculosis serotype IB (strain PB1/+)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMLVFGLVLSLTGIQSSSVQGLMIMAGLFGFGGAFVSLLMSKWMALR SVGGEVIERPRNETEYWLLETVRRQSQQVGIAMPQVAIYQAPDINAFATGARRDASLVAV STGLLQNMSRDEAEAVIAHEISHVANGDMVTMTLIQGVVNTFVIFISRLIAQIAAGFLSG DRDGESNSPGNPMVYFAVSMVLELVFGILASIITMWFSRHREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEAGSMMAFCINGKSKTFSELFMSHPPLDKRIEALRSGQYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium 3-(Ethoxycarbonyl)-2',4'-difluoro-[1,1'-biphenyl]-4-yl Sulfate
TRC-S743925-10MG 10 mg

Sodium 3-(Ethoxycarbonyl)-2',4'-difluoro-[1,1'-biphenyl]-4-yl Sulfate

Sign In for Pricing
View Details
1,2-O-Isopropylidene-Alpha-D-glucofuranose
TRC-I825125-25G 25 g

1,2-O-Isopropylidene-Alpha-D-glucofuranose

Sign In for Pricing
View Details
Tissue FFPE Sections, Brain
CS805873 5x 5 µm

Tissue FFPE Sections, Brain

Sign In for Pricing
View Details
SLC7A11 Human Recombinant Protein, Synthetic Nanodisc
TP721420 10 µg

SLC7A11 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details
Ɑ-Methoxy-ω-Succinamic Acid NHS Ester PEG
1220000-35.5G 5 g

Ɑ-Methoxy-ω-Succinamic Acid NHS Ester PEG

Sign In for Pricing
View Details
B7-1 (CD80) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B11]
TA501575BM 100 µL

B7-1 (CD80) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B11]

Sign In for Pricing
View Details