Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Erwinia tasmaniensis Protease HtpX (htpX)

This Recombinant Erwinia tasmaniensis Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

B2VJ57

Expression Region

1-293

Origin

Erwinia tasmaniensis (strain DSM 17950 / Et1/99)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLGVMVVFGLILSLTGIQSSSVMGLMIMAGLFGFGGAFVSLLMSKWMALR SVGGEVIEQPRNETERWLLDTIAKQSQQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSRDEAEAVLAHEVSHIANGDMVTMTLIQGIVNTFVIFISRILAQLAAGFMSG DREEEGNSNGNPMVYFVVSMVLELVFGIVASTITMWFSRHREFHADAGAARLAGSEKMIA ALQRLKTSYEPQEASSMMALCINGKSKSISELFMSHPPLDKRIEALRSGQYAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
BNC550017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL
BNC881073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL
BNC740008-500 1x 500 µL

MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL
BNC470043-500 1x 500 µL

P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), CF640R conjugate, 0.1mg/mL
BNC402166-500 1x 500 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vimentin (VM452), CF488A conjugate, 0.1mg/mL
BNC880452-500 1x 500 µL

Vimentin (VM452), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details