Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella dublin Protease HtpX (htpX)

This Recombinant Salmonella dublin Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

B5FTJ0

Expression Region

1-293

Origin

Salmonella dublin (strain CT_02021853)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLLIMALLFGFGGSFISLLMSKWMALK SVGGEVIEQPRNERERWLMNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRIIAQIAAGFLGG NRDEGEGSNGNPLIYFAVATVLELVFGILASIITMWFSRYREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRSGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(+)-Aromadendrene
TRC-A794200-50MG 50 mg

(+)-Aromadendrene

Sign In for Pricing
View Details
Aurora A (AURKA) Rabbit Polyclonal Antibody
TA371224 100 µL

Aurora A (AURKA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human TuberoinfundibULar peptide (PTH2) activation kit by CRISPRa
GA114385 1 Kit

Human TuberoinfundibULar peptide (PTH2) activation kit by CRISPRa

Sign In for Pricing
View Details
2-Phenylethylamine Hydroiodide
TRC-P399303-500MG 500 mg

2-Phenylethylamine Hydroiodide

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS712140 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
Reep2 Mouse Gene Knockout Kit (CRISPR)
KN514643 1 Kit

Reep2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details