Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella dublin Protease HtpX (htpX)

This Recombinant Salmonella dublin Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

B5FTJ0

Expression Region

1-293

Origin

Salmonella dublin (strain CT_02021853)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLLIMALLFGFGGSFISLLMSKWMALK SVGGEVIEQPRNERERWLMNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRIIAQIAAGFLGG NRDEGEGSNGNPLIYFAVATVLELVFGILASIITMWFSRYREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRSGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TARC (Thymus Activation Regulated Chemokine) ELISA Kit
E-EL-H0026-01 24 Tests

Human TARC (Thymus Activation Regulated Chemokine) ELISA Kit

Sign In for Pricing
View Details
Human TARC (Thymus Activation Regulated Chemokine) ELISA Kit
E-EL-H0026-02 48 Tests

Human TARC (Thymus Activation Regulated Chemokine) ELISA Kit

Sign In for Pricing
View Details
Human TARC (Thymus Activation Regulated Chemokine) ELISA Kit
E-EL-H0026-03 96 Tests

Human TARC (Thymus Activation Regulated Chemokine) ELISA Kit

Sign In for Pricing
View Details
CADM3 Antibody
KC-26903-01 50 μL

CADM3 Antibody

Sign In for Pricing
View Details
CADM3 Antibody
KC-26903-02 100 µL

CADM3 Antibody

Sign In for Pricing
View Details
CADM3 Antibody
KC-26903-03 1 mL

CADM3 Antibody

Sign In for Pricing
View Details