Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O7:K1 Protease HtpX (htpX)

This Recombinant Escherichia coli O7:K1 Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

B7NS90

Expression Region

1-293

Origin

Escherichia coli O7:K1 (strain IAI39 / ExPEC)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLMIMALLFGFGGSFVSLLMSKWMALR SVGGEVIEQPRNERERWLVNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRILAQLAAGFMGG NRDEGEESNGNPLIYFAVATVLELVFGILASIITMWFSRHREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRTGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF405M conjugate, 0.1mg/mL
BNC050322-100 1x 100 µL

CD3e (RIV9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL
BNC940965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (OCA125/2349R), CF594 conjugate, 0.1mg/mL
BNC942349-100 1x 100 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (OCA125/2349R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), Biotin conjugate, 0.1mg/mL
BNCB0175-500 1x 500 µL

CD46 (122.2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), CF405S conjugate, 0.1mg/mL
BNC041619-500 1x 500 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
BNC470391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details