Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pectobacterium carotovorum subsp. carotovorum Protease HtpX (htpX)

This Recombinant Pectobacterium carotovorum subsp. carotovorum Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

C6DFY1

Expression Region

1-293

Origin

Pectobacterium carotovorum subsp. carotovorum (strain PC1)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLITNLAVMLVFGLVLSLTGIQSSSVQGLMIMAGLFGFGGAFVSLLMSKWMALR SVGGEVIEQPRNETERWLVETVRTQSQQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSRDEAEAVIAHEISHIANGDMVTMTLVQGIVNTFVIFVSRLIAQVVSGFLSG NRDEGESSNGNPLVYFAVATVLELVFGILASIITMWFSRYREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEESSMMAFCINGKSKSFSELFMSHPPLDKRIEALRSGDYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-100 1x 100 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-100 1x 100 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1556R), CF405S conjugate, 0.1mg/mL
BNC041556-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (EGP40/1556R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (KLK3/2871R), CF568 conjugate, 0.1mg/mL
BNC682871-100 1x 100 µL

Prostate Specific Antigen (PSA) (KLK3/2871R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (HMB45), CF405S conjugate, 0.1mg/mL
BNC040444-500 1x 500 µL

Pmel17 / gp100 / SILV (HMB45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details