Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sodalis glossinidius Protease HtpX (htpX)

This Recombinant Sodalis glossinidius Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q2NTD3

Expression Region

1-293

Origin

Sodalis glossinidius (strain morsitans)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRISLFLLTNLAVMVVFGIVLSLTGIQSSSAAGLMIMAGLFGFGGAFVSLLMSKSMALR SVGGEVIEQPRNETERWLLNTVRQQAQQANITMPQVALYHAPDINAFATGARRDASLVAV STGLLQNMNRDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRILAQLAAGFMSS GRDEGESGNGNPLVYFAVSMVLELVFGVLASIITLWFSRHREFHADAGSARLVGREKMIA ALQRLKTSYEPQEASSMMAFCINGRNKTFSELFMSHPPLDKRIEALRSGAYLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TCIRG1 Antibody APC Conjugated
A05045-1-APC 100 µg/Vial

Anti-TCIRG1 Antibody APC Conjugated

Sign In for Pricing
View Details
Olfr1265 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4157806 1.0 µg DNA

Olfr1265 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant Human MS4A1 Protein, His-tagged, FITC conjugated
MS4A1-7308HF 20 μg- 50 μg- 100 μg

Recombinant Human MS4A1 Protein, His-tagged, FITC conjugated

Sign In for Pricing
View Details
Human Inhibin Beta A (INHbA) ELISA Kit
RD-INHbA-Hu-96Tests 96 Tests

Human Inhibin Beta A (INHbA) ELISA Kit

Sign In for Pricing
View Details
Recombinant Streptococcus Suis rpsT Protein (aa 1-82) (strain 05ZYH33)
VAng-Cr8366-500gEcoli 500 µg (E. coli)

Recombinant Streptococcus Suis rpsT Protein (aa 1-82) (strain 05ZYH33)

Sign In for Pricing
View Details
Eif4h (NM_033561) Mouse Tagged ORF Clone
MG218362 10 µg

Eif4h (NM_033561) Mouse Tagged ORF Clone

Sign In for Pricing
View Details