Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella boydii serotype 4 Protease HtpX (htpX)

This Recombinant Shigella boydii serotype 4 Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q321Y6

Expression Region

1-293

Origin

Shigella boydii serotype 4 (strain Sb227)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLMIMALLFGFGGSFVSLLMSKWMALR SVGGEVIEQPRNERERWLVNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRILAQLAAGFMGG NRDEGEESNGNPLIYFAVATVLELVFGILASIITMWFSRHREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRTGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IPO-38 Proliferation marker Mouse Monoclonal Antibody [Clone ID: SPM260]
AM33249PU-S 100 µg

IPO-38 Proliferation marker Mouse Monoclonal Antibody [Clone ID: SPM260]

Sign In for Pricing
View Details
Rat Stromal Cell Derived Factor 1 (SDF1) ELISA Kit
RD-SDF1-Ra-01 96 Tests

Rat Stromal Cell Derived Factor 1 (SDF1) ELISA Kit

Sign In for Pricing
View Details
Rat Stromal Cell Derived Factor 1 (SDF1) ELISA Kit
RD-SDF1-Ra-02 48 Tests

Rat Stromal Cell Derived Factor 1 (SDF1) ELISA Kit

Sign In for Pricing
View Details
SFTA2 (NM_205854) Human Over-expression Lysate
LC404203 20 µg

SFTA2 (NM_205854) Human Over-expression Lysate

Sign In for Pricing
View Details
Sucrose Octasulfate Octatriethylamine Salt (>90%)
TRC-S698992-5G 5 g

Sucrose Octasulfate Octatriethylamine Salt (>90%)

Sign In for Pricing
View Details
Human GPR89A activation kit by CRISPRa
GA118849 1 Kit

Human GPR89A activation kit by CRISPRa

Sign In for Pricing
View Details