Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella sonnei Protease HtpX (htpX)

This Recombinant Shigella sonnei Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q3Z2G8

Expression Region

1-293

Origin

Shigella sonnei (strain Ss046)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLMIMALLFGFGGSFVSLLMSKWMALR SVGGEVIEQPRNERERWLVNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRILAQLAAGFMGG NRDEGEESNGNPLIYFAVATVLELVFGILASIITMWFSRHREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRTGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc Bis(2-Ethylhexyl) Phosphorodithioate
TRC-Z438460-50MG 50 mg

Zinc Bis(2-Ethylhexyl) Phosphorodithioate

Sign In for Pricing
View Details
Serpin A5 Antibody
8C17739-AAT 50 µg

Serpin A5 Antibody

Sign In for Pricing
View Details
Human ZNF467 activation kit by CRISPRa
GA116176 1 Kit

Human ZNF467 activation kit by CRISPRa

Sign In for Pricing
View Details
Sulfanitran-d4 (Major)
TRC-S689042-25MG 25 mg

Sulfanitran-d4 (Major)

Sign In for Pricing
View Details
BCL2 Rabbit Monoclonal Antibody [Clone ID: 23GB680]
TA424557 100 µL

BCL2 Rabbit Monoclonal Antibody [Clone ID: 23GB680]

Sign In for Pricing
View Details
Hexanedioic Acid-1-13C
TRC-A291598-10MG 10 mg

Hexanedioic Acid-1-13C

Sign In for Pricing
View Details