Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protease HtpX (htpX)

This Recombinant Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q669V7

Expression Region

1-293

Origin

Yersinia pseudotuberculosis

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMLVFGLVLSLTGIQSSSVQGLMIMAGLFGFGGAFVSLLMSKWMALR SVGGEVIERPRNETEYWLLETVRRQSQQVGIAMPQVAIYQAPDINAFATGARRDASLVAV STGLLQNMSRDEAEAVIAHEISHVANGDMVTMTLIQGVVNTFVIFISRLIAQIAAGFLSG DRDGESNSPGNPMVYFAVSMVLELVFGILASIITMWFSRHREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEAGSMMAFCINGKSKTFSELFMSHPPLDKRIEALRSGQYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Brain Protein 44-Like Protein (BRP44L) Human ELISA Kit
B9258 96 Tests

Brain Protein 44-Like Protein (BRP44L) Human ELISA Kit

Sign In for Pricing
View Details
HCLS1-associated protein X-1 Polyclonal Conjugated Antibody
C42396 100 µL

HCLS1-associated protein X-1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
ARAP1 Rabbit Polyclonal Antibody
TA350875 100 µL

ARAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2310028H24Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3478406 1.0 µg DNA

2310028H24Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
ZL0454 25mg
A20123-25 25 mg

ZL0454 25mg

Sign In for Pricing
View Details
S S Metal Dispenser Wall Bracket
CO006-1X2NO 1 unit

S S Metal Dispenser Wall Bracket

Sign In for Pricing
View Details