Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protease HtpX (htpX)

This Recombinant Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q669V7

Expression Region

1-293

Origin

Yersinia pseudotuberculosis

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMLVFGLVLSLTGIQSSSVQGLMIMAGLFGFGGAFVSLLMSKWMALR SVGGEVIERPRNETEYWLLETVRRQSQQVGIAMPQVAIYQAPDINAFATGARRDASLVAV STGLLQNMSRDEAEAVIAHEISHVANGDMVTMTLIQGVVNTFVIFISRLIAQIAAGFLSG DRDGESNSPGNPMVYFAVSMVLELVFGILASIITMWFSRHREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEAGSMMAFCINGKSKTFSELFMSHPPLDKRIEALRSGQYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLK8 Antibody (OABF01618-100UL)
OABF01618-100UL 100 µL

KLK8 Antibody (OABF01618-100UL)

Sign In for Pricing
View Details
Phospho-PERK (Thr980) Polyclonal Antibody
bs-23340R 100 µL

Phospho-PERK (Thr980) Polyclonal Antibody

Sign In for Pricing
View Details
APC/XFD750 Anti-human CD14 Antibody *61D3*
101411E2-AAT 500 Tests

APC/XFD750 Anti-human CD14 Antibody *61D3*

Sign In for Pricing
View Details
ASCL1 Rabbit Polyclonal Antibody (FITC)
orb2144159 100 µL

ASCL1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Crk p38 Rabbit Polyclonal Antibody
orb196271 100 µg

Crk p38 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Plac1 shRNA (UAS) - Lentiviral mouse Plac1 shRNA (UAS, iRFP) plasmid
GTR15188584 1 Vial

Lentiviral mouse Plac1 shRNA (UAS) - Lentiviral mouse Plac1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details