Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Protease HtpX (htpX)

This Recombinant Salmonella paratyphi A Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q5PHN9

Expression Region

1-293

Origin

Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLLIMALLFGFGGSFISLLMSKWMALK SVGGEVIEQPRNERERWLMNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRIIAQIAAGFLGG NRDEGEGSNGNPLIYFAVATVLELVFGILASIITMWFSRYREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRSGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Red 780 Anti-Mouse CD4 Antibody[RM4-5]
E-AB-F1353S-01 50 Tests

Elab Fluor® Red 780 Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse CD4 Antibody[RM4-5]
E-AB-F1353S-02 100 Tests

Elab Fluor® Red 780 Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse CD4 Antibody[RM4-5]
E-AB-F1353S-03 2x 100 Tests

Elab Fluor® Red 780 Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
CD71 (66IG10), CF405S conjugate, 0.1mg/mL
BNC040871-100 1x 100 µL

CD71 (66IG10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Ckap5 activation kit by CRISPRa
GA210351 1 Kit

Mouse Ckap5 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Stomach
CR561840 5 µg

Tissue Total RNA, Stomach

Sign In for Pricing
View Details