Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Protease HtpX (htpX)

This Recombinant Salmonella paratyphi A Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q5PHN9

Expression Region

1-293

Origin

Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLLIMALLFGFGGSFISLLMSKWMALK SVGGEVIEQPRNERERWLMNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRIIAQIAAGFLGG NRDEGEGSNGNPLIYFAVATVLELVFGILASIITMWFSRYREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRSGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p21 Ras (HRAS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F2]
TA505665BM 100 µL

p21 Ras (HRAS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F2]

Sign In for Pricing
View Details
Glypican-3 (1G12), CF488A conjugate, 0.1mg/mL
BNC880862-100 1x 100 µL

Glypican-3 (1G12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast, left
CS714722 5x 5 µm

Tissue FFPE Sections, Breast, left

Sign In for Pricing
View Details
BRD1 Human Gene Knockout Kit (CRISPR)
KN417334 1 Kit

BRD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human PD-L1/B7-H1/CD274 protein (His tag)
PDEH100890-01 20 µg

Recombinant Human PD-L1/B7-H1/CD274 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PD-L1/B7-H1/CD274 protein (His tag)
PDEH100890-02 100 µg

Recombinant Human PD-L1/B7-H1/CD274 protein (His tag)

Sign In for Pricing
View Details