Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Protease HtpX (htpX)

This Recombinant Salmonella paratyphi A Protease HtpX (htpX) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q5PHN9

Expression Region

1-293

Origin

Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLLIMALLFGFGGSFISLLMSKWMALK SVGGEVIEQPRNERERWLMNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRIIAQIAAGFLGG NRDEGEGSNGNPLIYFAVATVLELVFGILASIITMWFSRYREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRSGEYLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFIP11 Human qPCR Primer Pair (NM_012143)
HP229808 200 Reactions

TFIP11 Human qPCR Primer Pair (NM_012143)

Sign In for Pricing
View Details
Thyroglobulin (TGB04 + TGB05), CF405S conjugate, 0.1mg/mL
BNC041227-100 1x 100 µL

Thyroglobulin (TGB04 + TGB05), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS702181 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
MAD3 Recombinant Rabbit Monoclonal Antibody [JE48-14]
ET7109-76 100 µL

MAD3 Recombinant Rabbit Monoclonal Antibody [JE48-14]

Sign In for Pricing
View Details
Human GRAMD4 activation kit by CRISPRa
GA108076 1 Kit

Human GRAMD4 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1992), 0.2mg/mL
BNUB1992-100 1x 100 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1992), 0.2mg/mL

Sign In for Pricing
View Details