Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Presqualene diphosphate phosphatase (Ppapdc2)

This Recombinant Rat Presqualene diphosphate phosphatase (Ppapdc2) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Presqualene diphosphate phosphatase, EC= 3.1.3.-, Phosphatidic acid phosphatase type 2 domain-containing protein 2

UniProt

Q66H88

Expression Region

1-293

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSPRRTIEGRPLGSSGGSSVPGSPAHGGGGGGSGRFEFQSLLSCRSGADPACARLRASD SPVHRRGSFPLAAACPAQVAPAPPPEDAGMNLNPSFLGIALRSLLAIDLWLSKKLGVCAG ESSAWGSVRPLMKLLEISGHGIPWLLGTLYCLLRSDSWAGREVLMNLLFALLLDLLLVAV IKGLVRRRRPAHNQMDMFFTLSVDKYSFPSGHATRAALVSRFILNHLVLAIPLRVLVVLW AFVLGLSRVMLGRHNVTDVAFGFFLGYMQYSIVDYCWLSPLNVPVLFVLWNQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Glutamine-amide-15N
TRC-G597002-25MG 25 mg

L-Glutamine-amide-15N

Sign In for Pricing
View Details
PSMG3 Human qPCR Primer Pair (NM_001134340)
HP227486 200 Reactions

PSMG3 Human qPCR Primer Pair (NM_001134340)

Sign In for Pricing
View Details
O-Desbromo-pyrimidinyl Macitentan
TRC-D282025-50MG 50 mg

O-Desbromo-pyrimidinyl Macitentan

Sign In for Pricing
View Details
OR5AK3P Antibody
8G471-AAT 50 µg

OR5AK3P Antibody

Sign In for Pricing
View Details
C9orf75 (TPRN) Human Gene Knockout Kit (CRISPR)
KN426062 1 Kit

C9orf75 (TPRN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAB34 Human qPCR Primer Pair (NM_001144943)
HP226745 200 Reactions

RAB34 Human qPCR Primer Pair (NM_001144943)

Sign In for Pricing
View Details