Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein YIF1A (YIF1A)

This Recombinant Human Protein YIF1A (YIF1A) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protein YIF1A, 54TMp, YIP1-interacting factor homolog A

UniProt

O95070

Expression Region

1-293

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAYHSGYGAHGSKHRARAAPDPPPLFDDTSGGYSSQPGGYPATGADVAFSVNHLLGDPMA NVAMAYGSSIASHGKDMVHKELHRFVSVSKLKYFFAVDTAYVAKKLGLLVFPYTHQNWEV QYSRDAPLPPRQDLNAPDLYIPTMAFITYVLLAGMALGIQKRFSPEVLGLCASTALVWVV MEVLALLLGLYLATVRSDLSTFHLLAYSGYKYVGMILSVLTGLLFGSDGYYVALAWTSSA LMYFIVRSLRTAALGPDSMGGPVPRQRLQLYLTLGAAAFQPLIIYWLTFHLVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N2-Benzyloxycarbonyl-L-ornithine
TRC-B285908-5G 5 g

N2-Benzyloxycarbonyl-L-ornithine

Sign In for Pricing
View Details
Tumor necrosis factor alpha induced protein 8 like protein 2 (TNFAIP8L2) (NM_024575) Human Over-expression Lysate
LC403005 20 µg

Tumor necrosis factor alpha induced protein 8 like protein 2 (TNFAIP8L2) (NM_024575) Human Over-expression Lysate

Sign In for Pricing
View Details
Human AGPAT3 activation kit by CRISPRa
GA111247 1 Kit

Human AGPAT3 activation kit by CRISPRa

Sign In for Pricing
View Details
KPNA2 Rabbit Polyclonal Antibody
TA370657 100 µL

KPNA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant ENPP5 Antibody
RC-16542-01 50 μL

Recombinant ENPP5 Antibody

Sign In for Pricing
View Details
Recombinant ENPP5 Antibody
RC-16542-02 100 µL

Recombinant ENPP5 Antibody

Sign In for Pricing
View Details