Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Putative maltodextrin utilization protein yvdJ (yvdJ)

This Recombinant Bacillus subtilis Putative maltodextrin utilization protein yvdJ (yvdJ) spans the amino acid sequence from region 1-294.

Product Specifications

Product Name Alternative

Putative maltodextrin utilization protein yvdJ

UniProt

O06992

Expression Region

1-294

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNLENKSFIIRCLKAAASPSGVCRYGNTFSWLQLSFLFLFLTACLMAPLAVSFVKMDRF SVSSFMPSAIQGVNDQFADQLQGFQIRNGKLTGGKSSERIEDGQNVMAVDMKHEYETSGE NGRLKVTGFENAIIFQPDQLVITDQNETGFSVGYAKMDVKLEKPNVHDVEVLIDTLWLAQ YKPMIMMLAYTVVSMIQLLLTFVLAGGLWITKISNMVSIASFKEAASIAICASALPAFAA AAIGMVHFDLITVLMIHSCGVTLMISFAFRYLTKTRRDNGNLHSGGNDDKSAVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF568 conjugate, 0.1mg/mL
BNC681564-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Diethyl Malonate-2-13C
TRC-D444421-50MG 50 mg

Diethyl Malonate-2-13C

Sign In for Pricing
View Details
b-Ionone
TRC-I731280-25G 25 g

b-Ionone

Sign In for Pricing
View Details
Uncoated Human IgM (Immunoglobulin M) ELISA Kit
E-UNEL-H0008-01 5x 96 Tests

Uncoated Human IgM (Immunoglobulin M) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human IgM (Immunoglobulin M) ELISA Kit
E-UNEL-H0008-02 15x 96 Tests

Uncoated Human IgM (Immunoglobulin M) ELISA Kit

Sign In for Pricing
View Details
IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM260), Biotin conjugate, 0.1mg/mL
BNCB3775-500 1x 500 µL

IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM260), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details