Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Putative maltodextrin utilization protein yvdJ (yvdJ)

This Recombinant Bacillus subtilis Putative maltodextrin utilization protein yvdJ (yvdJ) spans the amino acid sequence from region 1-294.

Product Specifications

Product Name Alternative

Putative maltodextrin utilization protein yvdJ

UniProt

O06992

Expression Region

1-294

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNLENKSFIIRCLKAAASPSGVCRYGNTFSWLQLSFLFLFLTACLMAPLAVSFVKMDRF SVSSFMPSAIQGVNDQFADQLQGFQIRNGKLTGGKSSERIEDGQNVMAVDMKHEYETSGE NGRLKVTGFENAIIFQPDQLVITDQNETGFSVGYAKMDVKLEKPNVHDVEVLIDTLWLAQ YKPMIMMLAYTVVSMIQLLLTFVLAGGLWITKISNMVSIASFKEAASIAICASALPAFAA AAIGMVHFDLITVLMIHSCGVTLMISFAFRYLTKTRRDNGNLHSGGNDDKSAVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTA2 Antibody, FITC conjugated
CSB-PA12659C0Rb-01 50 µg

ACTA2 Antibody, FITC conjugated

Sign In for Pricing
View Details
ACTA2 Antibody, FITC conjugated
CSB-PA12659C0Rb-02 100 µg

ACTA2 Antibody, FITC conjugated

Sign In for Pricing
View Details
FRMD7 Antibody Blocking peptide
orb1457181 500 µg

FRMD7 Antibody Blocking peptide

Sign In for Pricing
View Details
Mouse Nucleobindin 1 (NUCB1) ELISA Kit
orb780708-01 48 Tests

Mouse Nucleobindin 1 (NUCB1) ELISA Kit

Sign In for Pricing
View Details
Mouse Nucleobindin 1 (NUCB1) ELISA Kit
orb780708-02 96 Tests

Mouse Nucleobindin 1 (NUCB1) ELISA Kit

Sign In for Pricing
View Details
ALX1 Recombinant Protein (Human)
RP001105 100 µg

ALX1 Recombinant Protein (Human)

Sign In for Pricing
View Details