Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Putative maltodextrin utilization protein yvdJ (yvdJ)

This Recombinant Bacillus subtilis Putative maltodextrin utilization protein yvdJ (yvdJ) spans the amino acid sequence from region 1-294.

Product Specifications

Product Name Alternative

Putative maltodextrin utilization protein yvdJ

UniProt

O06992

Expression Region

1-294

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNLENKSFIIRCLKAAASPSGVCRYGNTFSWLQLSFLFLFLTACLMAPLAVSFVKMDRF SVSSFMPSAIQGVNDQFADQLQGFQIRNGKLTGGKSSERIEDGQNVMAVDMKHEYETSGE NGRLKVTGFENAIIFQPDQLVITDQNETGFSVGYAKMDVKLEKPNVHDVEVLIDTLWLAQ YKPMIMMLAYTVVSMIQLLLTFVLAGGLWITKISNMVSIASFKEAASIAICASALPAFAA AAIGMVHFDLITVLMIHSCGVTLMISFAFRYLTKTRRDNGNLHSGGNDDKSAVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAX1BP3 (Tax1 (human T-Cell Leukemia Virus Type I) Binding Protein 3, TIP-1) (AP)
MBS6164045-01 0.1 mL

TAX1BP3 (Tax1 (human T-Cell Leukemia Virus Type I) Binding Protein 3, TIP-1) (AP)

Sign In for Pricing
View Details
TAX1BP3 (Tax1 (human T-Cell Leukemia Virus Type I) Binding Protein 3, TIP-1) (AP)
MBS6164045-02 5x 0.1 mL

TAX1BP3 (Tax1 (human T-Cell Leukemia Virus Type I) Binding Protein 3, TIP-1) (AP)

Sign In for Pricing
View Details
HIF3A Protein Vector (Mouse) (pPM-C-His)
PV188629 500 ng

HIF3A Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Cdk5r1 Rabbit Polyclonal Antibody (HRP)
orb2144862 100 µL

Cdk5r1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Sheep Probable Palmitoyltransferase ZDHHC23 (ZDHHC23) ELISA Kit
MBS9940013-01 48 Well

Sheep Probable Palmitoyltransferase ZDHHC23 (ZDHHC23) ELISA Kit

Sign In for Pricing
View Details
Sheep Probable Palmitoyltransferase ZDHHC23 (ZDHHC23) ELISA Kit
MBS9940013-02 96 Well

Sheep Probable Palmitoyltransferase ZDHHC23 (ZDHHC23) ELISA Kit

Sign In for Pricing
View Details