Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 110 (TMEM110)

This Recombinant Human Transmembrane protein 110 (TMEM110) spans the amino acid sequence from region 1-294.

Product Specifications

Product Name Alternative

Transmembrane protein 110

UniProt

Q86TL2

Expression Region

1-294

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQGPAGNASRGLPGGPPSTVASGAGRCESGALMHSFGIFLQGLLGVVAFSTLMLKRFREP KHERRPWRIWFLDTSKQAIGMLFIHFANVYLADLTEEDPCSLYLINFLLDATVGMLLIYV GVRAVSVLVEWQQWESLRFGEYGDPLQCGAWVGQCALYIVIMIFEKSVVFIVLLILQWKK VALLNPIENPDLKLAIVMLIVPFFVNALMFWVVDNFLMRKGKTKAKLEERGANQDSRNGS KVRYRRAASHEESESEILISADDEMEESDVEEDLRRLTPLKPVKKKKHRFGLPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thimerosal
TRC-T344530-25G 25 g

Thimerosal

Sign In for Pricing
View Details
CD28 (C28/74), CF640R conjugate, 0.1mg/mL
BNC400074-100 1x 100 µL

CD28 (C28/74), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Myostatin Propeptide (MSTN) (NM_005259) Human Recombinant Protein
TP310368 20 µg

Myostatin Propeptide (MSTN) (NM_005259) Human Recombinant Protein

Sign In for Pricing
View Details
Human SH3TC1 activation kit by CRISPRa
GA110098 1 Kit

Human SH3TC1 activation kit by CRISPRa

Sign In for Pricing
View Details
Rabbit Anti-Goat IgG Biotinylated Antibody Kit
BAK-008 1 mL

Rabbit Anti-Goat IgG Biotinylated Antibody Kit

Sign In for Pricing
View Details
6-Azidohexanoic Acid
TRC-A850030-250MG 250 mg

6-Azidohexanoic Acid

Sign In for Pricing
View Details