Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Tetraspanin-15 (TSPAN15)

This Recombinant Bovine Tetraspanin-15 (TSPAN15) spans the amino acid sequence from region 1-294.

Product Specifications

Product Name Alternative

Tetraspanin-15, Tspan-15

UniProt

Q1JQA4

Expression Region

1-294

Origin

Bos taurus (Bovine)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPRGDSEQVRYCARFSYLWLKFSLVIYSTVFWLIGGLVLSVGIYAEVERQKYKTLESAFL APAIILILLGVVMFIVSFIGVLASLRDNLCLLQAFMYILGICLIIELIGGVVALIFRNQT IDFLNDNIRRGIENYYDDLDFKNIMDFVQKEFKCCGGEDYRDWSKNQYHDCRAPGPLACG VPYTCCFRNTTEVVNTMCGYKTIDKERLSVQNVIYVRGCTNAVLMWFTDNYTIMAGVLLG ILLPQFLGVLLTFLYITRVEDIITEHSVTDGLLGPGTKAGVEAAGTGCCMCYPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL
BNC880151-500 1x 500 µL

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (IGHG4/2042R), CF568 conjugate, 0.1mg/mL
BNC682042-100 1x 100 µL

Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (IGHG4/2042R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/1931), CF594 conjugate, 0.1mg/mL
BNC941931-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/1931), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF594 conjugate, 0.1mg/mL
BNC940871-100 1x 100 µL

CD71 (66IG10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF640R conjugate, 0.1mg/mL
BNC400305-500 1x 500 µL

CD95 (B-R18), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (r1415-1), CF594 conjugate, 0.1mg/mL
BNC941797-500 1x 500 µL

Histone H1 (Nuclear Marker) (r1415-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details