Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetraspanin-15 (TSPAN15)

This Recombinant Human Tetraspanin-15 (TSPAN15) spans the amino acid sequence from region 1-294.

Product Specifications

Product Name Alternative

Tetraspanin-15, Tspan-15, Tetraspan NET-7, Transmembrane 4 superfamily member 15

UniProt

O95858

Expression Region

1-294

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPRGDSEQVRYCARFSYLWLKFSLIIYSTVFWLIGALVLSVGIYAEVERQKYKTLESAFL APAIILILLGVVMFMVSFIGVLASLRDNLYLLQAFMYILGICLIMELIGGVVALTFRNQT IDFLNDNIRRGIENYYDDLDFKNIMDFVQKKFKCCGGEDYRDWSKNQYHDCSAPGPLACG VPYTCCIRNTTEVVNTMCGYKTIDKERFSVQDVIYVRGCTNAVIIWFMDNYTIMAGILLG ILLPQFLGVLLTLLYITRVEDIIMEHSVTDGLLGPGAKPSVEAAGTGCCLCYPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC37 (CFAP100) (N-term) Rabbit Polyclonal Antibody
AP50776PU-N 400 µL

CCDC37 (CFAP100) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) Mouse Monoclonal Antibody [Clone ID: CK-18]
AM20608PU-N 100 µg

Cytokeratin 18 (KRT18) Mouse Monoclonal Antibody [Clone ID: CK-18]

Sign In for Pricing
View Details
6X His tag Recombinant Mouse monoclonal Antibody
HA610016 100 µg

6X His tag Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
BioCoupler® Glass Set (8 oz) x6
BCS86 6 Each

BioCoupler® Glass Set (8 oz) x6

Sign In for Pricing
View Details
Recombinant SV2A Monoclonal Antibody
AN301990L-01 50 µL

Recombinant SV2A Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant SV2A Monoclonal Antibody
AN301990L-02 100 µL

Recombinant SV2A Monoclonal Antibody

Sign In for Pricing
View Details