Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-15 (Tspan15)

This Recombinant Mouse Tetraspanin-15 (Tspan15) spans the amino acid sequence from region 1-294.

Product Specifications

Product Name Alternative

Tetraspanin-15, Tspan-15, Transmembrane 4 superfamily member 15

UniProt

F7BWT7

Expression Region

1-294

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPRGDSEQVRYCARFSYLWLKFSLIIYSTVFWLIGGLVLSVGIYAEAERQKYKTLESAFL APAIILILLGVVMFIVSFIGVLASLRDNLCLLQSFMYILGICLVMELIGGIVALIFRNQT IDFLNDNIRRGIENYYDDLDFKNIMDFVQKKFKCCGGEDYRDWSKNQYHDCSAPGPLACG VPYTCCIRNTTDVVNTMCGYKTIDKERLNAQNIIHVRGCTNAVLIWFMDNYTIMAGLLLG ILLPQFLGVLLTLLYITRVEDIILEHSVTDGLLGPGAKSRTDTAGTGCCLCYPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLK3 (25-261aa) Monoclonal Antibody
E53M01465 100 µL

KLK3 (25-261aa) Monoclonal Antibody

Sign In for Pricing
View Details
TTC21B AAV siRNA Pooled Vector
48670161 1.0 µg

TTC21B AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Phosphatidylethanolamine Binding Protein 4 (PEBP4) BioAssayTM ELISA Kit (Human)
366411 96 Tests

Phosphatidylethanolamine Binding Protein 4 (PEBP4) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
1- (2-Bromoisovaleryl) Urea
OR1029210 25 g

1- (2-Bromoisovaleryl) Urea

Sign In for Pricing
View Details
Bovine TNF related activation induced cytokine(TRANCE) ELISA Kit
MBS2609902-01 48 Well

Bovine TNF related activation induced cytokine(TRANCE) ELISA Kit

Sign In for Pricing
View Details
Bovine TNF related activation induced cytokine(TRANCE) ELISA Kit
MBS2609902-02 96 Well

Bovine TNF related activation induced cytokine(TRANCE) ELISA Kit

Sign In for Pricing
View Details