Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-15 (Tspan15)

This Recombinant Mouse Tetraspanin-15 (Tspan15) spans the amino acid sequence from region 1-294.

Product Specifications

Product Name Alternative

Tetraspanin-15, Tspan-15, Transmembrane 4 superfamily member 15

UniProt

F7BWT7

Expression Region

1-294

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPRGDSEQVRYCARFSYLWLKFSLIIYSTVFWLIGGLVLSVGIYAEAERQKYKTLESAFL APAIILILLGVVMFIVSFIGVLASLRDNLCLLQSFMYILGICLVMELIGGIVALIFRNQT IDFLNDNIRRGIENYYDDLDFKNIMDFVQKKFKCCGGEDYRDWSKNQYHDCSAPGPLACG VPYTCCIRNTTDVVNTMCGYKTIDKERLNAQNIIHVRGCTNAVLIWFMDNYTIMAGLLLG ILLPQFLGVLLTLLYITRVEDIILEHSVTDGLLGPGAKSRTDTAGTGCCLCYPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal GITR/TNFRSF18 Antibody (2375B) [PE/Cy7]
FAB52412PECY7 0.1 mL

Rabbit Monoclonal GITR/TNFRSF18 Antibody (2375B) [PE/Cy7]

Sign In for Pricing
View Details
OR9I1 CytoSection
TS420570P5 25 Slides

OR9I1 CytoSection

Sign In for Pricing
View Details
Recombinant Mouse S100A9 Protein, N-His
MY562012-01 50 µg

Recombinant Mouse S100A9 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse S100A9 Protein, N-His
MY562012-02 100 µg

Recombinant Mouse S100A9 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse S100A9 Protein, N-His
MY562012-03 1 mg

Recombinant Mouse S100A9 Protein, N-His

Sign In for Pricing
View Details
Polysorbate 20
orb2900257-01 100 mg

Polysorbate 20

Sign In for Pricing
View Details