Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida Protease HtpX (htpX)

This Recombinant Pseudomonas putida Protease HtpX (htpX) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

B0KUP8

Expression Region

1-295

Origin

Pseudomonas putida (strain GB-1)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRILLFVATNLAVVLVASITLSLFGFNGFMAANGVDLNLSSLLVFCAVFGFAGSLVSLF ISKWMAKMSTGTQIISQPRTRHEQWLLQTVEELSREAGIKMPEVGIFPAYEANAFATGWN RNDALVAVSQGLLERFSPDEVRAVLAHEIGHVANGDMVTLALVQGVVNTFVMFFARIIGN FVDKVIFKNEEGQGIAYYVATIVAELILGILASMIVMWFSRRREYRADEAGAQLAGTSAM IGALQRLRVEQGLPVHMPDTMKAFGINGGLKHGLAGLLMSHPPLEDRIEALRRRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC18 AAV siRNA Pooled Vector
15240161 1.0 µg

CCDC18 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ZPBP2 Rabbit pAb
E47R16409 100 µL

ZPBP2 Rabbit pAb

Sign In for Pricing
View Details
2- ((1S,3S,4aS,9aR) -6- (Dimethylamino) -1- (hydroxymethyl) -3,4,4a,9a-tetrahydro-1H-pyrano[3,4-b]benzofuran-3-yl) -N- (4-phenoxybenzyl) acet amide
QMC82799-01 10 mg

2- ((1S,3S,4aS,9aR) -6- (Dimethylamino) -1- (hydroxymethyl) -3,4,4a,9a-tetrahydro-1H-pyrano[3,4-b]benzofuran-3-yl) -N- (4-phenoxybenzyl) acet amide

Sign In for Pricing
View Details
2- ((1S,3S,4aS,9aR) -6- (Dimethylamino) -1- (hydroxymethyl) -3,4,4a,9a-tetrahydro-1H-pyrano[3,4-b]benzofuran-3-yl) -N- (4-phenoxybenzyl) acet amide
QMC82799-02 25 mg

2- ((1S,3S,4aS,9aR) -6- (Dimethylamino) -1- (hydroxymethyl) -3,4,4a,9a-tetrahydro-1H-pyrano[3,4-b]benzofuran-3-yl) -N- (4-phenoxybenzyl) acet amide

Sign In for Pricing
View Details
2- ((1S,3S,4aS,9aR) -6- (Dimethylamino) -1- (hydroxymethyl) -3,4,4a,9a-tetrahydro-1H-pyrano[3,4-b]benzofuran-3-yl) -N- (4-phenoxybenzyl) acet amide
QMC82799-03 50 mg

2- ((1S,3S,4aS,9aR) -6- (Dimethylamino) -1- (hydroxymethyl) -3,4,4a,9a-tetrahydro-1H-pyrano[3,4-b]benzofuran-3-yl) -N- (4-phenoxybenzyl) acet amide

Sign In for Pricing
View Details
Rangrf (NM_001285442) Mouse Tagged ORF Clone
MR228306 10 µg

Rangrf (NM_001285442) Mouse Tagged ORF Clone

Sign In for Pricing
View Details