Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida Protease HtpX (htpX)

This Recombinant Pseudomonas putida Protease HtpX (htpX) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

B0KUP8

Expression Region

1-295

Origin

Pseudomonas putida (strain GB-1)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRILLFVATNLAVVLVASITLSLFGFNGFMAANGVDLNLSSLLVFCAVFGFAGSLVSLF ISKWMAKMSTGTQIISQPRTRHEQWLLQTVEELSREAGIKMPEVGIFPAYEANAFATGWN RNDALVAVSQGLLERFSPDEVRAVLAHEIGHVANGDMVTLALVQGVVNTFVMFFARIIGN FVDKVIFKNEEGQGIAYYVATIVAELILGILASMIVMWFSRRREYRADEAGAQLAGTSAM IGALQRLRVEQGLPVHMPDTMKAFGINGGLKHGLAGLLMSHPPLEDRIEALRRRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCG-beta (hCGb/459), CF640R conjugate, 0.1mg/mL
BNC400211-100 1x 100 µL

HCG-beta (hCGb/459), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P-M2tide
BML-P239-0001 1 mg

P-M2tide

Sign In for Pricing
View Details
DENND5B Antibody Blocking Peptide
orb1512510 500 µg

DENND5B Antibody Blocking Peptide

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster General odorant-binding protein 99a (Obp99a)
MBS1284148-01 0.02 mg (E-Coli)

Recombinant Drosophila melanogaster General odorant-binding protein 99a (Obp99a)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster General odorant-binding protein 99a (Obp99a)
MBS1284148-02 0.1 mg (E-Coli)

Recombinant Drosophila melanogaster General odorant-binding protein 99a (Obp99a)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster General odorant-binding protein 99a (Obp99a)
MBS1284148-03 0.02 mg (Yeast)

Recombinant Drosophila melanogaster General odorant-binding protein 99a (Obp99a)

Sign In for Pricing
View Details