Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida Protease HtpX (htpX)

This Recombinant Pseudomonas putida Protease HtpX (htpX) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

B0KUP8

Expression Region

1-295

Origin

Pseudomonas putida (strain GB-1)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRILLFVATNLAVVLVASITLSLFGFNGFMAANGVDLNLSSLLVFCAVFGFAGSLVSLF ISKWMAKMSTGTQIISQPRTRHEQWLLQTVEELSREAGIKMPEVGIFPAYEANAFATGWN RNDALVAVSQGLLERFSPDEVRAVLAHEIGHVANGDMVTLALVQGVVNTFVMFFARIIGN FVDKVIFKNEEGQGIAYYVATIVAELILGILASMIVMWFSRRREYRADEAGAQLAGTSAM IGALQRLRVEQGLPVHMPDTMKAFGINGGLKHGLAGLLMSHPPLEDRIEALRRRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TREK 1 Antibody [Dylight 680]
NB110-41535FR 0.1 mL

Rabbit Polyclonal TREK 1 Antibody [Dylight 680]

Sign In for Pricing
View Details
MRPS36P6 Adenovirus (Human)
30597051 1.0 mL

MRPS36P6 Adenovirus (Human)

Sign In for Pricing
View Details
SARS-CoV-2 S1 protein NTD (L18F, T20N, P26S, D138Y, R190S), His Tag (MALS verified)
S1D-C52He-100ug 100 µg

SARS-CoV-2 S1 protein NTD (L18F, T20N, P26S, D138Y, R190S), His Tag (MALS verified)

Sign In for Pricing
View Details
Atp5f1 sgRNA CRISPR Lentivector set (Mouse)
K4709301 3x 1.0 µg

Atp5f1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Mir6941 qPCR Primer Pair
QM80674S 200 Tests

Mouse Mir6941 qPCR Primer Pair

Sign In for Pricing
View Details
SCF Receptor (Stem Cell Factor Receptor, SCFR, SCF-R, C-kit, CD117)
216922 50 µg

SCF Receptor (Stem Cell Factor Receptor, SCFR, SCF-R, C-kit, CD117)

Sign In for Pricing
View Details